« Zurück
Startseite /
Recombinant Macaca fascicularis Trophoblast glycoprotein(TPBG),partial

Recombinant Macaca fascicularis Trophoblast glycoprotein(TPBG),partial

ArtNr	CSB-MP024093MOV-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 50 ug
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins By Organ Testicular & Prostate Cancer
Typ	Proteins Recombinant
Specific against	other
Konjugat/Tag	Myc, HIS
Purity	Greater than 95% as determined by SDS-PAGE.
Sequence	TSSASSSSSSAPFLASAASAQPPLPDQCPALCECS EAARTVKCVNRNLTEVPTDLPLYVRNLFLTGNQLA VLPAGAFARRPPLAELAALNLSGSRLDEVRGGAFE HLPSLRQLDLSHNPLAYLSPFAFSGSNASISAPSP LVELILNHIVPPDDKRQNRSFEGMVAAALVAGRAL QGLHLLELASNHFLYLPRDVLAQLPSLRYLDLSNN SLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLA ELQ
Citations	"DNA sequences of macaque genes expressed in brain or testis and its evolutionary implications." International consortium for macaque cDNA sequencing and analysis Submitted (JUN-2005)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Wnt-activated inhibitory factor 1,WAIF1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged and C-terminal Myc-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	39.9 kDa
Buffer	Tris-based buffer, 50% glycerol
Relevance	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Expression Region	35-355aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May function as an inhibitor of Wnt/beta-catenin signaling by indirectly interacting with LRP6 and blocking Wnt3a-dependent LRP6 internalization.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Gene Names	TPBG
Sequence Info	Extracellular Domain
Organism	Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP024093MOV-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern