« Zurück
Startseite /
Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

Recombinant Mouse Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial(Dlat)

ArtNr	CSB-MP804374MO-20
Hersteller	Cusabio
Menge	20 ug
Quantity options	10 ug 100 ug 1 mg 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	Mammalian cells
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	SLPPHQKVPLPSLSPTMQAGTIARWEKKEGEKISE GDLIAEVETDKATVGFESLEECYMAKILVPEGTRD VPVGSIICITVEKPQDIEAFKNYTLDLAAAAAPQA APAAAPAPAAAPAAPSASAPGSSYPTHMQIVLPAL SPTMTMGTVQRWEKKVGEKLSEGDLLAEIETDKAT IGFEVQEEGYLAKILVPEGTRDVPLGAPLCIIVEK QEDIAAFADYRPTEVTSLKPQAAPPAPPPVAAVPP TPQ
Citations	The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).The MGC Project Team Genome Res. 14:2121-2127(2004)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex,Pyruvate dehydrogenase complex component E2
Lieferbar
Manufacturer - Type	Protein
Manufacturer - Targets	Dlat
Manufacturer - Conjugate / Tag	N-terminal 10xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	61.3 kDa
Buffer	If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas	Signal Transduction
Relevance	The pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO2, and thereby links the glycolytic pathway to the tricarboxylic cycle.
Expression Region	86-642aa
Protein Length	Full Length of Mature Protein
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Biological activity	Not Test
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-MP804374MO-20-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 20 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern