« Zurück
Startseite /
Recombinant Mouse C-X-C motif chemokine 9(Cxcl9)

Recombinant Mouse C-X-C motif chemokine 9(Cxcl9)

ArtNr	CSB-RP092694m-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TLVIRNARCSCISTSRGTIHYKSLKDLKQFAPSPN CNKTEIIATLKNGDQTCLDPDSANVKKLMKEWEKK ISQKKKQKRGKKHQKNMKNRKPKTPQSRRRSRKTT
Citations	A macrophage mRNA selectively induced by gamma-interferon encodes a member of the platelet factor 4 family of cytokines.Farber J.M.Proc. Natl. Acad. Sci. U.S.A. 87:5238-5242(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Gamma-interferon-induced monokine;Monokine induced by interferon-gamma ;MIG ;MuMIGProtein m119Small-inducible cytokine B9
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 16, 2
Relevance	May be a cytokine that affects the growth, movent, or activation state of cells that participate in immune and inflammatory response.
Expression Region	22-126aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names	Cxcl9
Sequence Info	Full Length
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 02.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern