« Zurück
Startseite /
Recombinant Zea mays Auxin-binding protein 1(ABP1)

Recombinant Zea mays Auxin-binding protein 1(ABP1)

ArtNr	CSB-RP141374pl-100
Hersteller	Cusabio
Menge	100 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	SCVRDNSLVRDISQMPQSSYGIEGLSHITVAGALN HGMKEVEVWLQTISPGQRTPIHRHSCEEVFTVLKG KGTLLMGSSSLKYPGQPQEIPFFQNTTFSIPVNDP HQVWNSDEHEDLQVLVIISRPPAKIFLYDDWSMPH TAAVLKFPFVWDEDCFEAAKDEL
Citations	Molecular analysis of three maize 22KDA auxin-binding protein genes -- transient promoter expression and regulatory regions.Schwob E., Choi S.-Y., Simmons C., Migliaccio F., Ilag L., Hesse T., Palme K., Soell D.Plant J. 4:423-432(1993)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	ERABP1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	22.4 kDa
Relevance	This is probably a receptor for the plant hormone auxin.
Expression Region	39-201aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Receptor for the plant hormone auxin.
Subcellular Location	Endoplasmic reticulum lumen
Tissue Specificity	Expressed in roots, coleoptiles, leaves, stems, tassels and ears.
Gene Names	ABP1
Sequence Info	Full Length of Mature Protein
Organism	Zea mays (Maize)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 16.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern