« Zurück
Startseite /
Recombinant Hirudo medicinalis Hirudin variant-1

Recombinant Hirudo medicinalis Hirudin variant-1

ArtNr	CSB-RP182644Ba-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	other
Host	E.coli
Konjugat/Tag	GST
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGE KNQCVTGEGTPKPQSHNDGDFEEIPEEYLQ
Citations	Role of interactions involving C-terminal nonpolar residues of hirudin in the formation of the thrombin-hirudin complex.Betz A., Hofsteenge J., Stone S.R.Biochemistry 30:9848-9853(1991)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Specificity	Hirudo medicinalis (Medicinal leech)
Manufacturer - Conjugate / Tag	N-terminal GST-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	MW of Fusion: 34
Buffer	Tris-based buffer, 50% glycerol
Relevance	Hirudin is a potent thrombin-specific protease inhibitor. It forms a stable non-covalent complex with alpha-thrombin, thereby abolishing its ability to cleave fibrinogen.
Expression Region	1-65aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Sequence Info	Full Length
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 13.11.2025