« Zurück
Startseite /
Recombinant Human CD81 antigen(CD81),partial

Recombinant Human CD81 antigen(CD81),partial

ArtNr	CSB-YP004960HU-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Neuroscience Neural Lineage Markers Peptides & Proteins Recombinant Proteins By Organ Skin Cancer Lymphatic System Cancer
Typ	Proteins Recombinant
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVV KTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNII SNLFKEDCHQKIDDLFSGK
Protein Familie	Tetraspanin (TM4SF) family
Citations	TAPA-1, the target of an antiproliferative antibody, defines a new family of transmembrane proteins.Oren R., Takahashi S., Doss C., Levy R., Levy S.Mol. Cell. Biol. 10:4007-4015(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	26KDA cell surface protein TAPA-1Target of the antiproliferative antibody 1Tetraspanin-28 ,Tspan-28,CD81
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	11.8 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Immunology
Relevance	May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-KDA Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.
Expression Region	113-201aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	May play an important role in the regulation of lymphoma cell growth. Interacts with a 16-kDa Leu-13 protein to form a complex possibly involved in signal transduction. May act as the viral receptor for HCV.; FUNCTION
Subcellular Location	Basolateral cell membrane, Multi-pass membrane protein
Tissue Specificity	Hematolymphoid, neuroectodermal and mesenchymal tumor cell lines.
Involvement in disease	Immunodeficiency, common variable, 6 (CVID6)
Pathway	Bcellreceptorsignalingpathway
Gene Names	CD81
Sequence Info	Extracellular Domain
Organism	Homo sapiens (Human)
Manufacturer - Format	Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP004960HU-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 12.02.2026

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern