« Zurück
Startseite /
Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)

Recombinant Mouse Plasminogen activator inhibitor 1(Serpine1)

ArtNr	CSB-YP021081MO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Breast Cancer Uterine, Ovarian & Cervical Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	TLPLRESHTAHQATDFGVKVFQQVVQASKDRNVVF SPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEK GTAHALRQLSKELMGPWNKNEISTADAIFVQRDLE LVQGFMPHFFKLFQTMVKQVDFSEVERARFIINDW VERHTKGMINDLLAKGAVDELTRLVLVNALYFSGQ WKTPFLEASTHQRLFHKSDGSTVSVPMMAQSNKFN YTEFTTPDGLEYDVVELPYQRDTLSMFIAAPFEKD VHL
Protein Familie	Serpin family
Citations	The c-myc-regulated gene mr1 encodes plasminogen activator inhibitor 1.Prendergast G.C., Diamond L.E., Dahl D., Cole M.D.Mol. Cell. Biol. 10:1265-1269(1990)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Endothelial plasminogen activator inhibitorSerpin E1
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	44.9 kDa
Relevance	Serine protease inhibitor. This inhibitor acts as 'bait' for tissue plasminogen activator, urokinase, protein C and matriptase-3/TMPRSS7. Its rapid interaction with PLAT may function as a major control point in the regulation of fibrinolysis .
Expression Region	23-402aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Serine protease inhibitor. Inhibits TMPRSS7. Is a primary inhibitor of tissue-type plasminogen activator (PLAT) and urokinase-type plasminogen activator (PLAU). As PLAT inhibitor, it is required for fibrinolysis down-regulation and is responsible for the controlled degradation of blood clots. As PLAU inhibitor, it is involved in the regulation of cell adhesion and spreading. Acts as a regulator of cell migration, independently of its role as protease inhibitor. It is required for stimulation of keratinocyte migration during cutaneous injury repair (By similarity). Involved in cellular and replicative senescence
Subcellular Location	Secreted
Gene Names	Serpine1
Sequence Info	Full Length of Mature Protein
Organism	Mus musculus (Mouse)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP021081MO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern