Hersteller |
Cusabio
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
other |
Format |
Liquid or Lyophilized powder |
Menge |
10ug |
Host |
Yeast |
ArtNr |
CSB-YP021844MO-10 |
eClass 6.1 |
34160400 |
eClass 9.0 |
42020190 |
Lieferbar |
|
Research Topic |
Others |
Uniprot ID |
Q99K82 |
Gene Names |
Smox |
Organism |
Mus musculus (Mouse) |
AA Sequence |
MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLA GLAAARALLEQGFTDVTVLEASSHIGGRVQSVRLG DTTFELGATWIHGSHGNPIYQLAEANGLLEETTDG ERSVGRISLYSKNGVACYLTNRGCRIPKDVVEEFS DLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREK VRNRIRDDPDDTEATKRLKLAMIQQYLKVESCESS SHSIDEVSLSAFGEWTEIPGAHHIIPSGFMRVVEL LAEGIPPHVIQLGKPVRCIHWDQASAHPRGPEIEP RGEGDHNHDTGEGGQSGENPQQGRWDEDEPWPVVV ECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPCLP TEKVAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQ FVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY GHVLSGWICGEEALVMERCDDEAVAEICTEMLRQF TGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSS GADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKY YSTTHGALLSGQREAARLIEMYRDLFQQGP |
Expression Region |
1-555aa |
Sequence Info |
Full Length |
Source |
Yeast |
Tag Info |
N-terminal 6xHis-tagged |
MW |
63.9 kDa |
Alternative Name(s) |
Polyamine oxidase 1 Short name: PAO-1 Short name: PAOh1 |
Relevance |
Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal. |
Reference |
"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004) |
Purity |
Greater than 90% as determined by SDS-PAGE. |
Storage Buffer |
Tris-based buffer, 50% glycerol |
Storage |
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. |
Notes |
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Function |
Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal. |
Subcellular Location |
Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Nucleus |
Protein Families |
Flavin monoamine oxidase family |
Tissue Specificity |
Widely expressed. Isoform 1 and isoform 2 are expressed at higher level in brain and skeletal muscle. Isoform 7 is found in brain and spleen, isoform 10 is widely expressed but found at lower level in heart, kidney, liver and lung. |
Tag Information |
N-terminal 6xHis-tagged |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.