« Back
Home /
Recombinant Mouse Spermine oxidase(Smox)

Recombinant Mouse Spermine oxidase(Smox)

Manufacturer	Cusabio
Category	Oncology Peptides & Proteins Recombinant Proteins By Organ Bladder Cancer
Type	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Amount	10ug
Host	Yeast
Item no.	CSB-YP021844MO-10
eClass 6.1	34160400
eClass 9.0	42020190
Available
Research Topic	Others
Uniprot ID	Q99K82
Gene Names	Smox
Organism	Mus musculus (Mouse)
AA Sequence	MQSCESSGDSADDPLSRGLRRRGQPRVVVIGAGLA GLAAARALLEQGFTDVTVLEASSHIGGRVQSVRLG DTTFELGATWIHGSHGNPIYQLAEANGLLEETTDG ERSVGRISLYSKNGVACYLTNRGCRIPKDVVEEFS DLYNEVYNMTQEFFRHGKPVNAESQNSVGVFTREK VRNRIRDDPDDTEATKRLKLAMIQQYLKVESCESS SHSIDEVSLSAFGEWTEIPGAHHIIPSGFMRVVEL LAEGIPPHVIQLGKPVRCIHWDQASAHPRGPEIEP RGEGDHNHDTGEGGQSGENPQQGRWDEDEPWPVVV ECEDCEVIPADHVIVTVSLGVLKRQYTSFFRPCLP TEKVAAIHRLGIGTTDKIFLEFEEPFWGPECNSLQ FVWEDEAESCTLTYPPELWYRKICGFDVLYPPERY GHVLSGWICGEEALVMERCDDEAVAEICTEMLRQF TGNPNIPKPRRILRSAWGSNPYFRGSYSYTQVGSS GADVEKLAKPLPYTESSKTAPMQVLFSGEATHRKY YSTTHGALLSGQREAARLIEMYRDLFQQGP
Expression Region	1-555aa
Sequence Info	Full Length
Source	Yeast
Tag Info	N-terminal 6xHis-tagged
MW	63.9 kDa
Alternative Name(s)	Polyamine oxidase 1 Short name: PAO-1 Short name: PAOh1
Relevance	Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal.
Reference	"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."The MGC Project Team Genome Res. 14:2121-2127(2004)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Flavoenzyme which catalyzes the oxidation of spermine to spermidine. Can also use N(1)-acetylspermine and spermidine as substrates, with different affinity depending on the isoform (isozyme) and on the experimental conditions. Plays an important role in the regulation of polyamine intracellular concentration and has the potential to act as a determinant of cellular sensitivity to the antitumor polyamine analogs. May contribute to beta-alanine production via aldehyde dehydrogenase conversion of 3-amino-propanal.
Subcellular Location	Cytoplasm, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Nucleus
Protein Families	Flavin monoamine oxidase family
Tissue Specificity	Widely expressed. Isoform 1 and isoform 2 are expressed at higher level in brain and skeletal muscle. Isoform 7 is found in brain and spleen, isoform 10 is widely expressed but found at lower level in heart, kidney, liver and lung.
Tag Information	N-terminal 6xHis-tagged

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 10ug

available

Request delivery time