Vergleich

Recombinant Candida albicans pH-regulated antigen PRA1(PRA1)

ArtNr CSB-YP308545CZD-10
Hersteller Cusabio
Menge 10 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host Yeast
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence APVTVTRFVDASPTGYDWRADWVKGFPIDSSCNAT QYNQLSTGLQEAQLLAEHARDHTLRFGSKSPFFRK YFGNETASAEVVGHFDNVVGADKSSILFLCDDLDD KCKNDGWAGYWRGSNHSDQTIICDLSFVTRRYLTQ LCSSGYTVSKSKTNIFWAGDLLHRFWHLKSIGQLV IEHYADTYEEVLELAQENSTYAVRNSNSLIYYALD VYAYDVTIPGEGCNGDGTSYKKSDFSSFEDSDSGS DSG
Protein Familie ZPS1 family
Citations "Assembly of the Candida albicans genome into sixteen supercontigs aligned on the eight chromosomes."
van het Hoog M., Rast T.J., Martchenko M., Grindle S., Dignard D., Hogues H., Cuomo C., Berriman M., Scherer S., Magee B.B., Whiteway M., Chibana H., Nantel A., Magee P.T.
Genome Biol. 8:RESEARCH52.1-RESEARCH52.12(2007)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias 58 kDa fibrinogen-binding mannoprotein,FBP1
Lieferbar
Manufacturer - Targets
PRA1
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
33.4 kDa
General Research Areas
Signal Transduction
Relevance
Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.
Expression Region
16-299aa
Protein Length
Full Length of Mature Protein
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Cell surface protein involved in the host-parasite interaction during candidal infection. With MP65, represents a major component of the biofilm matrix. Sequesters zinc from host tissue and mediates leukocyte adhesion and migration. As a surface protein, binds the two human complement regulators CFH and CFHR1, as well as plasminogen PLG, mediates complement evasion and extra-cellular matrix interaction and/or degradation. As a released protein, enhances complement control in direct vicinity of the yeast and thus generates an additional protective layer which controls host complement attack, assisting the fungus in escaping host surveillance. Binds to host fluid-phase C3 and blocks cleavage of C3 to C3a and C3b, leading to inhibition of complement activation. Mediates also human complement control and complement evasion through binding to C4BPA, another human complement inhibitor, as well as through binding to host integrin alpha-M/beta-2. Decreases complement-mediated adhesion, as well as uptake of C.albicans by human macrophages.
Subcellular Location
Secreted
Biological activity
Not Test
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen