« Zurück
Startseite /
Recombinant Porphyromonas gingivalis Gingipain R1(rgpA),partial

Recombinant Porphyromonas gingivalis Gingipain R1(rgpA),partial

ArtNr	CSB-YP338957PQP-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	YTPVEEKQNGRMIVIVAKKYEGDIKDFVDWKNQRG LRTEVKVAEDIASPVTANAIQQFVKQEYEKEGNDL TYVLLVGDHKDIPAKITPGIKSDQVYGQIVGNDHY NEVFIGRFSCESKEDLKTQIDRTIHYERNITTEDK WLGQALCIASAEGGPSADNGESDIQHENVIANLLT QYGYTKIIKCYDPGVTPKNIIDAFNGGISLVNYTG HGSETAWGTSHFGTTHVKQLTNSNQLPFIFDVACV NGD
Protein Familie	Peptidase C25 family
Citations	Structural characterization of argingipain, a novel arginine-specific cysteine proteinase as a major periodontal pathogenic factor from Porphyromonas gingivalis.Okamoto K., Misumi Y., Kadowaki T., Yoneda M., Yamamoto K., Ikehara Y.Arch. Biochem. Biophys. 316:917-925(1995)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Arg-gingipain;Gingipain 1RGP-1
Lieferbar
Manufacturer - Targets	rgpA
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	56 kDa
Relevance	Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Its proteolytic activity is a major factor in both periodontal tissue destruction and in bacterial host defense mechanisms. Activates complent C3 and C5.
Expression Region	228-720aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Thiol protease. Acts synergistically with RgpB to catalyze the maturation of fimbrial subunits, such as FimA (By similarity). Its proteolytic activity is a major factor in both periodontal tissue destruction and in evasion of host defense mechanisms (Probable).
Subcellular Location	Secreted
Biologically active	Not Test
Protein length	Partial

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP338957PQP-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern