« Zurück
Startseite /
Recombinant Erythrina caffra Trypsin inhibitor DE-3

Recombinant Erythrina caffra Trypsin inhibitor DE-3

ArtNr	CSB-YP362840EGO-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Food Safety Proteins Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	VLLDGNGEVVQNGGTYYLLPQVWAQGGGVQLAKTG EETCPLTVVQSPNELSDGKPIRIESRLRSAFIPDD DKVRIGFAYAPKCAPSPWWTVVEDEQEGLSVKLSE DESTQFDYPFKFEQVSDQLHSYKLLYCEGKHEKCA SIGINRDQKGYRRLVVTEDYPLTVVLKKDESS
Protein Familie	Protease inhibitor I3 (leguminous Kunitz-type inhibitor) family
Citations	The primary structure of the inhibitor of tissue plasminogen activator found in the seeds of Erythrina caffra.Joubert F.J., Dowdle E.B.D.Thromb. Haemost. 57:356-360(1987)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	21.3 kDa
Relevance	Inhibition of trypsin.
Expression Region	1-172aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Inhibition of trypsin.
Biologically active	Not Test
Protein length	Full Length

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP362840EGO-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern