« Zurück
Startseite /
Recombinant Human Histone-lysine N-methyltransferase NSD3(NSD3)

Recombinant Human Histone-lysine N-methyltransferase NSD3(NSD3)

ArtNr	CSB-YP880145HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Konjugat/Tag	HIS
Purity	Greater than 85% as determined by SDS-PAGE.
Sequence	MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFD NNSDIAEDGGQTPYEATLQQGFQYPATTEDLPPLT NGYPSSISVYETQTKYQSYNQYPNGSANGFGAVRN FSPTDYYHSEIPNTRPHEILEKPSPPQPPPPPSVP QTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGD LLNEVQASEHTKSKHESRKEKRKKSNKHDSSRSEE RKSHKIPKLEPEEQNRPNERVDTVSEKPREEPVLK EEA
Protein Familie	Class V-like SAM-binding methyltransferase superfamily, Histone-lysine methyltransferase family, SET2 subfamily
Citations	"WHSC1L1, on human chromosome 8p11.2, closely resembles WHSC1 and maps to a duplicated region shared with 4p16.3." Stec I., van Ommen G.-J.B., den Dunnen J.T. Genomics 76:5-8(2001)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Nuclear SET domain-containing protein 3 (Protein whistle) (WHSC1-like 1 isoform 9 with methyltransferase activity to lysine) (Wolf-Hirschhorn syndrome candidate 1-like protein 1) (WHSC1-like protein 1) (WHSC1L1)
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	73.9 kDa
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
Expression Region	1-645aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Histone methyltransferase. Preferentially methylates 'Lys-4' and 'Lys-27' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation, while 'Lys-27' is a mark for transcriptional repression.
Subcellular Location	Nucleus, Chromosome
Tissue Specificity	Highly expressed in brain, heart and skeletal muscle. Expressed at lower level in liver and lung.
Involvement in disease	Defects in NSD3 may be involved in non small cell lung carcinomas (NSCLC). Amplified or overexpressed in NSCLC.
Gene Names	WHSC1L1
Sequence Info	Full Length of Isoform 3
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP880145HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 25.09.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern