« Zurück
Startseite /
Recombinant Human Protein-arginine deiminase type-2(PADI2)

Recombinant Human Protein-arginine deiminase type-2(PADI2)

ArtNr	CSB-YP896493HU-200
Hersteller	Cusabio
Menge	200 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Solid
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPA GAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWL LSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIP IDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASW TWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSK EDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSD KVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGS AEL
Protein Familie	Protein arginine deiminase family
Citations	Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro.Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.DNA Res. 6:63-70(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	PAD-H19Peptidylarginine deiminase IIProtein-arginine deiminase type II
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	77.6 kDa
Buffer	Tris-based buffer, 50% glycerol
General Research Areas	Epigenetics and Nuclear Signaling
Relevance	Catalyzes the deimination of arginine residues of proteins.
Expression Region	1-665aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Catalyzes the deimination of arginine residues of proteins.
Subcellular Location	Cytoplasm
Gene Names	PADI2
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Manufacturer - Format	Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP896493HU-200-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200 ug

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern