« Zurück
Home /
Recombinant Human Receptor-interacting serine/threonine-protein kinase 3(RIPK3)

Recombinant Human Receptor-interacting serine/threonine-protein kinase 3(RIPK3)

ArtNr	CSB-YP897497HU-10
Hersteller	Cusabio
Menge	10 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Neuroscience Neural Lineage Markers Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience Peptides & Proteins Recombinant Proteins Microglia Markers
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTV FRAQHRKWGYDVAVKIVNSKAISREVKAMASLDNE FVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGL LQSQCPRPWPLLCRLLKEVVLGMFYLHDQNPVLLH RDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTG SGEPGGTLGYLAPELFVNVNRKASTASDVYSFGIL MWAVLAGREVELPTEPSLVYEAVCNRQNRPSLAEL PQA
Protein Familie	Protein kinase superfamily, TKL Ser/Thr protein kinase family
Citations	"Identification of RIP3, a RIP-like kinase that activates apoptosis and NFkappaB."Yu P.W., Huang B.C.B., Shen M., Quast J., Chan E., Xu X., Nolan G.P., Payan D.G., Luo Y.Curr. Biol. 9:539-542(1999)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	RIP-like protein kinase 3; Receptor-interacting protein 3; Short name:; RIP-3
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	58.9 kDa
General Research Areas	Cell Biology
Relevance	Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes: GLUL, GLUD1, and PYGL. These metabolic enzymes may eventually stimulate the tricarboxylic acid cycle and oxidative phosphorylation, which could result in enhanced ROS production.
Expression Region	1-518aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Essential for necroptosis, a programmed cell death process in response to death-inducing TNF-alpha family members. Upon induction of necrosis, RIPK3 interacts with, and phosphorylates RIPK1 and MLKL to form a necrosis-inducing complex. RIPK3 binds to and enhances the activity of three metabolic enzymes
Subcellular Location	Cytoplasm, cytosol, Cell membrane, Mitochondrion
Tissue Specificity	Highly expressed in the pancreas. Detected at lower levels in heart, placenta, lung and kidney. Isoform 3 is significantly increased in colon and lung cancers.
Paythway	TNFsignalingpathway
Gene Names	RIPK3
Sequence Info	Full Length
Organism	Homo sapiens (Human)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP897497HU-10-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 10 ug

lieferbar

Lieferung vsl. bis 31.07.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail