Vergleich

Recombinant Rat Calcium/calmodulin-dependent protein kinase type IV(Camk4)

ArtNr CSB-EP004471RA-200
Hersteller Cusabio
Menge 200 ug
Quantity options 1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against other
Host E.coli
Konjugat/Tag HIS
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLKVTVPSCPSSPCSSVTSSTENLVPDYWIDGSKR DPLSDFFEVESELGRGATSIVYRCKQKGTQKPYAL KVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFE TPTEISLVLELVTGGELFDRIVEKGYYSERDAADA VKQILEAVAYLHENGIVHRDLKPENLLYATPAPDA PLKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILR GCAYGPEVDMWSVGIITYILLCGFEPFYDERGDQF MFR
Protein Familie Protein kinase superfamily, CAMK Ser/Thr protein kinase family, CaMK subfamily
Citations Catalytic activity is required for calcium/calmodulin-dependent protein kinase IV to enter the nucleus.Lemrow S.M., Anderson K.A., Joseph J.D., Ribar T.J., Noeldner P.K., Means A.R.J. Biol. Chem. 279:11664-11671(2004)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CaM kinase-GR,Calspermin
Lieferbar
Manufacturer - Conjugate / Tag
N-terminal 6xHis-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
57.2 kDa
Buffer
Tris-based buffer, 50% glycerol
Relevance
Isoform 1: Calcium/calmodulin-dependent protein kinase that operates in the calcium-triggered CaMKK-CaMK4 signaling cascade and regulates, mainly by phosphorylation, the activity of several transcription activators, such as CREB1, MEF2D, JUN and RORA, which play pivotal roles in immune response, inflammation, and mory consolidation. In the thymus, regulates the CD4+/CD8+ double positive thymocytes selection threshold during T-cell ontogeny. In CD4 mory T-cells, is required to link T-cell antigen receptor (TCR) signaling to the production of IL2, IFNG and IL4 (through the regulation of CREB and MEF2). Regulates the differentiation and survival phases of osteoclasts and dendritic cells (DCs). Mediates DCs survival by linking TLR4 and the regulation of tporal expression of BCL2. Phosphorylates the transcription activator CREB1 on 'Ser-133' in hippocampal neuron nuclei and contribute to mory consolidation and long term potentiation (LTP) in the hippocampus. Can activate the MAP kinases MAPK1/ERK2, MAPK8/JNK1 and MAPK14/p38 and stimulate transcription through the phosphorylation of ELK1 and ATF2. Can also phosphorylate in vitro CREBBP, PRM2, MEF2A and STMN1/OP18 .Isoform 2: Heat-stable, acidic, calmodulin-binding protein.
Expression Region
1-474aa
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function
Isoform 1
Subcellular Location
Cytoplasm, Nucleus
Tissue Specificity
Isoform 1 is expressed in brain and isoform 2 is testis specific.
Gene Names
Camk4
Sequence Info
Full Length
Organism
Rattus norvegicus (Rat)
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 200 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen