« Zurück
Home /
Recombinant Rat Urokinase plasminogen activator surface receptor(Plaur)

Recombinant Rat Urokinase plasminogen activator surface receptor(Plaur)

Hersteller	Cusabio
Kategorie	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Breast Cancer Thyroid Cancer
Typ	Proteins Recombinant
Specific against	other
Format	Liquid or Lyophilized powder
Menge	200ug
Host	E.coli
ArtNr	CSB-EP018122RA-200
eClass 6.1	34160400
eClass 9.0	42020190
Lieferbar
Research Topic	Others
Uniprot ID	P49616
Gene Names	Plaur
Organism	Rattus norvegicus (Rat)
AA Sequence	LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDA EELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETV CATNLCNRPRPGARGRPFPRGRYLECASCTSLDQS CERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEP YTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCN GGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSL IDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWC QGSHVADSFQTHVNLSISCCNGSGCNRPTG
Expression Region	25-299aa
Sequence Info	Full Length of Mature Protein
Source	E.coli
Tag Info	N-terminal 6xHis-tagged
MW	34.1 kDa
Alternative Name(s)	CD87
Relevance	Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Reference	The receptor for the plasminogen activator of urokinase type is up-regulated in transformed rat thyroid cells.Ragno P., Cassano S., Degen J., Kessler C., Blasi F., Rossi G.FEBS Lett. 306:193-198(1992)
Purity	Greater than 90% as determined by SDS-PAGE.
Storage Buffer	Tris-based buffer, 50% glycerol
Storage	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Subcellular Location	Isoform 1: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 2: Secreted
Tag Information	N-terminal 6xHis-tagged

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkdatenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 200ug

lieferbar

Vergleichen

Auf den Wunschzettel

Weiterempfehlen per Mail

Angebot anfordern

Lieferzeit anfragen