« Zurück
Startseite /
Recombinant Rat Urokinase plasminogen activator surface receptor(Plaur)

Recombinant Rat Urokinase plasminogen activator surface receptor(Plaur)

ArtNr	CSB-YP018122RA-50
Hersteller	Cusabio
Menge	50 ug
Quantity options	1 mg 10 ug 100 ug 20 ug 200 ug 50 ug 500 ug
Kategorie	Oncology Food Safety Proteins Peptides & Proteins Recombinant Proteins By Organ Breast Cancer
Typ	Proteins Recombinant
Format	Liquid or Lyophilized powder
Specific against	other
Host	Yeast
Konjugat/Tag	HIS
Purity	Greater than 90% as determined by SDS-PAGE.
Sequence	LRCIQCESNQDCLVEECALGQDLCRTTVLREWEDA EELEVVTRGCAHKEKTNRTMSYRMGSVIVSLTETV CATNLCNRPRPGARGRPFPRGRYLECASCTSLDQS CERGREQSLQCRYPTEHCIEVVTLQSTERSVKDEP YTKGCGSLPGCPGTAGFHSNQTFHFLKCCNFTQCN GGPVLDLQSLPPNGFQCYSCEGNSTFGCSYEETSL IDCRGPMNQCLEATGLDVLGNRSYTVRGCATASWC QGS
Citations	Transcriptional and posttranscriptional activation of urokinase plasminogen activator gene expression in metastatic tumor cells.Henderson B.R., Tansey W.P., Phillips S.M., Ramshaw I.A., Kefford R.F.Cancer Res. 52:2489-2496(1992)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Lieferbar
Manufacturer - Conjugate / Tag	N-terminal 6xHis-tagged
Storage Conditions	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight	32.1kDa
Relevance	Specifically cleaves the zymogen plasminogen to form the active enzyme plasmin.
Expression Region	25-299aa
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Function	Acts as a receptor for urokinase plasminogen activator. Plays a role in localizing and promoting plasmin formation. Mediates the proteolysis-independent signal transduction activation effects of U-PA.
Subcellular Location	Isoform 1: Cell membrane, Lipid-anchor, GPI-anchor, SUBCELLULAR LOCATION: Isoform 2: Secreted
Gene Names	Plaur
Sequence Info	Full Length of Mature Protein
Organism	Rattus norvegicus (Rat)
Storage Buffer	Tris-based buffer, 50% glycerol

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

CSB-YP018122RA-50-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 30.10.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern