Peptide B, bovine

ArtNr	RP10431-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Peptides & Proteins Cell Biology Cell Movement Cell Adhesion Peptides By Organ Skin Cancer
Typ	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF ; {PHE}{ALA}{GLU}{PRO}{LEU}{PRO}{SER}{GLU}{GLU}{GLU}{GLY}{GLU}{SER}{TYR}{SER}{LYS}{GLU}{VAL}{PRO}{GLU}{MET}{GLU}{LYS}{ARG}{TYR}{GLY}{GLY}{PHE}{MET}{ARG}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10431-Peptide_B, Bovine peptide B is interpreted as a physiological substance which probably acts on some smooth muscle receptor. Bovine peptide B from fibrinogen was active in the hemostasis of rat tail arterioles. The time of bleeding exhibits an inverse log proportionality to the concentration of bovine peptide-B. The peptide produced a 10-fold decrease in the time of bleeding at the highest concentration tested.</td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Storage at -20C. Keep tightly closed. </td></tr>
Similar products	Peptide
Lieferbar
Country of Origin	USA
Storage Conditions	Storage at -20C. Keep tightly closed.
Description	Bovine peptide B is interpreted as a physiological substance which probably acts on some smooth muscle receptor. Bovine peptide B from fibrinogen was active in the hemostasis of rat tail arterioles. The time of bleeding exhibits an inverse log proportionality to the concentration of bovine peptide-B. The peptide produced a 10-fold decrease in the time of bleeding at the highest concentration tested.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 13.11.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern