« Back
Home /
Peptide B, bovine

Peptide B, bovine

Item no.	RP10431-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Peptides & Proteins Cell Biology Cell Movement Cell Adhesion Peptides By Organ Skin Cancer
Type	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	FAEPLPSEEEGESYSKEVPEMEKRYGGFMRF ; {PHE}{ALA}{GLU}{PRO}{LEU}{PRO}{SER}{GLU}{GLU}{GLU}{GLY}{GLU}{SER}{TYR}{SER}{LYS}{GLU}{VAL}{PRO}{GLU}{MET}{GLU}{LYS}{ARG}{TYR}{GLY}{GLY}{PHE}{MET}{ARG}{PHE}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10431-Peptide_B, Bovine peptide B is interpreted as a physiological substance which probably acts on some smooth muscle receptor. Bovine peptide B from fibrinogen was active in the hemostasis of rat tail arterioles. The time of bleeding exhibits an inverse log proportionality to the concentration of bovine peptide-B. The peptide produced a 10-fold decrease in the time of bleeding at the highest concentration tested.</td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Storage at -20C. Keep tightly closed. </td></tr>
Similar products	Peptide
Available
Country of Origin	USA
Storage Conditions	Storage at -20C. Keep tightly closed.
Description	Bovine peptide B is interpreted as a physiological substance which probably acts on some smooth muscle receptor. Bovine peptide B from fibrinogen was active in the hemostasis of rat tail arterioles. The time of bleeding exhibits an inverse log proportionality to the concentration of bovine peptide-B. The peptide produced a 10-fold decrease in the time of bleeding at the highest concentration tested.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 11/13/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer