« Zurück
Startseite /
Growth Hormone Releasing Factor (GHRF), bovine

Growth Hormone Releasing Factor (GHRF), bovine

ArtNr	RP10735-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 ; {TYR}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{ASN}{SER}{TYR}{ARG}{LYS}{VAL}{LEU}{GLY}{GLN}{LEU}{SER}{ALA}{ARG}{LYS}{LEU}{LEU}{GLN}{ASP}{ILE}{MET}{ASN}{ARG}{GLN}{GLN}{GLY}{GLU}{ARG}{ASN}{GLN}{GLU}{GLN}{GLY}{ALA}{LYS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10735-Growth_Hormone_Releasing_Factor_GHRF_bovine, A 29-amino acid analog of growth hormone releasing factor (GHRF) was designed in which the sequence of the first six amino acids at the amino terminus was maintained while the postulated amphiphilic helical structure in the remainder of the molecule was optimized. The amino acid sequence of the analog differed from that of the first 29 residues of human GHRF by 13 residues. The peptide was synthesized by the solid-phase procedure in amide and free acid forms, both of which were tested for biological activity. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Growth
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	A 29-amino acid analog of growth hormone releasing factor (GHRF) was designed in which the sequence of the first six amino acids at the amino terminus was maintained while the postulated amphiphilic helical structure in the remainder of the molecule was optimized. The amino acid sequence of the analog differed from that of the first 29 residues of human GHRF by 13 residues. The peptide was synthesized by the solid-phase procedure in amide and free acid forms, both of which were tested for biological activity.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern