« Back
Home /
Growth Hormone Releasing Factor (GHRF), bovine

Growth Hormone Releasing Factor (GHRF), bovine

Item no.	RP10735-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	Cattle (Bovine)
Purity	> 95%
Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2 ; {TYR}{ALA}{ASP}{ALA}{ILE}{PHE}{THR}{ASN}{SER}{TYR}{ARG}{LYS}{VAL}{LEU}{GLY}{GLN}{LEU}{SER}{ALA}{ARG}{LYS}{LEU}{LEU}{GLN}{ASP}{ILE}{MET}{ASN}{ARG}{GLN}{GLN}{GLY}{GLU}{ARG}{ASN}{GLN}{GLU}{GLN}{GLY}{ALA}{LYS
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10735-Growth_Hormone_Releasing_Factor_GHRF_bovine, A 29-amino acid analog of growth hormone releasing factor (GHRF) was designed in which the sequence of the first six amino acids at the amino terminus was maintained while the postulated amphiphilic helical structure in the remainder of the molecule was optimized. The amino acid sequence of the analog differed from that of the first 29 residues of human GHRF by 13 residues. The peptide was synthesized by the solid-phase procedure in amide and free acid forms, both of which were tested for biological activity. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Growth
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	A 29-amino acid analog of growth hormone releasing factor (GHRF) was designed in which the sequence of the first six amino acids at the amino terminus was maintained while the postulated amphiphilic helical structure in the remainder of the molecule was optimized. The amino acid sequence of the analog differed from that of the first 29 residues of human GHRF by 13 residues. The peptide was synthesized by the solid-phase procedure in amide and free acid forms, both of which were tested for biological activity.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer