Secretin, chicken

ArtNr	RP12944
Hersteller	GenScript
Menge	0.2 mg
Kategorie	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience By Cell Type Peptides & Proteins Peptides
Typ	Peptides
Specific against	Chicken (Gallus gallus domesticus)
Purity	> 95%
Sequence	HSDGLFTSEYSKMRGNAQVQKFIQNLM-NH2 ; {HIS}{SER}{ASP}{GLY}{LEU}{PHE}{THR}{SER}{GLU}{TYR}{SER}{LYS}{MET}{ARG}{GLY}{ASN}{ALA}{GLN}{VAL}{GLN}{LYS}{PHE}{ILE}{GLN}{ASN}{LEU}{MET}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP12944-Secretin_SCT_Chicken, Chicken secretin is composed of 27 amino acid residues, and has an amidated C terminus. Chicken secretin further shows a clear structural similarity to the vasoactive intestinal peptide, the gastric inhibitory peptide and to glucagon, suggesting wide evolutionary and functional relationships. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	Secretin
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	Chicken secretin is composed of 27 amino acid residues, and has an amidated C terminus. Chicken secretin further shows a clear structural similarity to the vasoactive intestinal peptide, the gastric inhibitory peptide and to glucagon, suggesting wide evolutionary and functional relationships.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.2 mg

lieferbar

Lieferung vsl. bis 01.01.2026

Express-Lieferung: 2 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern