« Back
Home /
Secretin, chicken

Secretin, chicken

Item no.	RP12944
Manufacturer	GenScript
Amount	0.2 mg
Category	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience By Cell Type Peptides & Proteins Peptides
Type	Peptides
Specific against	Chicken (Gallus gallus domesticus)
Purity	> 95%
Sequence	HSDGLFTSEYSKMRGNAQVQKFIQNLM-NH2 ; {HIS}{SER}{ASP}{GLY}{LEU}{PHE}{THR}{SER}{GLU}{TYR}{SER}{LYS}{MET}{ARG}{GLY}{ASN}{ALA}{GLN}{VAL}{GLN}{LYS}{PHE}{ILE}{GLN}{ASN}{LEU}{MET}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP12944-Secretin_SCT_Chicken, Chicken secretin is composed of 27 amino acid residues, and has an amidated C terminus. Chicken secretin further shows a clear structural similarity to the vasoactive intestinal peptide, the gastric inhibitory peptide and to glucagon, suggesting wide evolutionary and functional relationships. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	Secretin
Available
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	Chicken secretin is composed of 27 amino acid residues, and has an amidated C terminus. Chicken secretin further shows a clear structural similarity to the vasoactive intestinal peptide, the gastric inhibitory peptide and to glucagon, suggesting wide evolutionary and functional relationships.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.2 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer