VIP, guinea pig

ArtNr	RP10084
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Peptides By Organ Skin Cancer Testicular & Prostate Cancer
Typ	Peptides
Specific against	Guinea Pig
Purity	> 95%
Sequence	HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 ; {HIS}{SER}{ASP}{ALA}{LEU}{PHE}{THR}{ASP}{THR}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{MET}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{VAL}{LEU}{ASN}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10084-VIP_guinea_pig, Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Like PACAP, a closely related peptide, VIP is largely inhibitory in the gastrointestinal tract and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. To characterize the effects of VIP on both contraction and relaxation of guinea pig gallbladder (GPGB) muscle, cumulative additions of VIP was performed with strips at basal tone or with strips pre-contracted with cholecystokinin-octapeptid, and VIP had no effect on basal tone. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> -20C </td></tr>
Similar products	VIP
Lieferbar
Country of Origin	USA
Storage Conditions	-20°C
Description	Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Like PACAP, a closely related peptide, VIP is largely inhibitory in the gastrointestinal tract and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. To characterize the effects of VIP on both contraction and relaxation of guinea pig gallbladder (GPGB) muscle, cumulative additions of VIP was performed with strips at basal tone or with strips pre-contracted with cholecystokinin-octapeptid, and VIP had no effect on basal tone.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern