« Back
Home /
VIP, guinea pig

VIP, guinea pig

Item no.	RP10084
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Targets for Rodent Neurosciences Neural Signaling Peptides & Proteins Peptides By Organ Skin Cancer Testicular & Prostate Cancer
Type	Peptides
Specific against	Guinea Pig
Purity	> 95%
Sequence	HSDALFTDTYTRLRKQMAMKKYLNSVLN-NH2 ; {HIS}{SER}{ASP}{ALA}{LEU}{PHE}{THR}{ASP}{THR}{TYR}{THR}{ARG}{LEU}{ARG}{LYS}{GLN}{MET}{ALA}{MET}{LYS}{LYS}{TYR}{LEU}{ASN}{SER}{VAL}{LEU}{ASN}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10084-VIP_guinea_pig, Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Like PACAP, a closely related peptide, VIP is largely inhibitory in the gastrointestinal tract and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. To characterize the effects of VIP on both contraction and relaxation of guinea pig gallbladder (GPGB) muscle, cumulative additions of VIP was performed with strips at basal tone or with strips pre-contracted with cholecystokinin-octapeptid, and VIP had no effect on basal tone. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> -20C </td></tr>
Similar products	VIP
Available
Country of Origin	USA
Storage Conditions	-20°C
Description	Peptide VIP is a vasodilator, bronchodilator and smooth muscle relaxant. Like PACAP, a closely related peptide, VIP is largely inhibitory in the gastrointestinal tract and its neuroprotective actions are mediated by the release of activity-dependent neurotrophic factors from glial cells. To characterize the effects of VIP on both contraction and relaxation of guinea pig gallbladder (GPGB) muscle, cumulative additions of VIP was performed with strips at basal tone or with strips pre-contracted with cholecystokinin-octapeptid, and VIP had no effect on basal tone.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer