« Zurück
Startseite /
Glucagon-Like Peptide (GLP) II, human

Glucagon-Like Peptide (GLP) II, human

ArtNr	RP10769-0.5
Hersteller	GenScript
Menge	0,5 mg
Kategorie	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Peptides
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	HADGSFSDEMNTILDNLAARDFINWLIQTKITD ; {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10769-Glucagon-Like_Peptide_II_GLP-2_human, Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr>
Similar products	Glucagon-Like
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Peptides & Chemicals
Country of Origin	USA
Shipping Temperature	25°C
Storage Conditions	-20°C
Product Line	Other Peptides
Description	Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0,5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 6 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern