Comparison

Glucagon-Like Peptide (GLP) II, human European Partner

Item no. RP10769-0.5
Manufacturer GenScript
Amount 0,5 mg
Category
Type Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD ; {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10769-Glucagon-Like_Peptide_II_GLP-2_human, Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr>
Similar products Glucagon-Like
Shipping Condition Room temperature
Available
Manufacturer - Category
Peptides & Chemicals
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Other Peptides
Description
Glucagon-like peptide 2 (GLP-2) is a recently identified intestinal epithelium-specific growth factor that has been shown to reduce the severity of inflammatory disorders of the intestine in rodent models. Currently Glucagon-Like Peptide 2 is used as a potential therapeutic agent for the human subjects with a broad variety of intestinal diseases characterized by intestinal damage and insufficiency.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0,5 mg
Available: In stock
available

Delivery expected until 11/27/2025 

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close