Vergleich

Glucagon-Like Peptide (GLP) II-Arg, human Europäischer Partner

ArtNr RP10774-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITDR ; {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}{ARG}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10774-Glucagon-Like_Peptide_2-Arg_GLP-2-Arg_human, Glucagon-like peptide 2 is a neuropeptide that inhibits food intake when injected into the lateral ventricles of the brain and may mediate satiety. It is also a growth factor that stimulates proliferation and blocks apoptosis of intestinal epithelial cells. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products Glucagon-Like
Lieferbar
Country of Origin
USA
Storage Conditions
Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description
Glucagon-like peptide 2 is a neuropeptide that inhibits food intake when injected into the lateral ventricles of the brain and may mediate satiety. It is also a growth factor that stimulates proliferation and blocks apoptosis of intestinal epithelial cells.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen