« Back
Home /
Glucagon-Like Peptide (GLP) II-Arg, human

Glucagon-Like Peptide (GLP) II-Arg, human

Item no.	RP10774-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Metabolism Diabetes Glucose Homeostasis Peptides & Proteins Cardiovascular Research Ischemia & Reperfusion Injury Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	HADGSFSDEMNTILDNLAARDFINWLIQTKITDR ; {HIS}{ALA}{ASP}{GLY}{SER}{PHE}{SER}{ASP}{GLU}{MET}{ASN}{THR}{ILE}{LEU}{ASP}{ASN}{LEU}{ALA}{ALA}{ARG}{ASP}{PHE}{ILE}{ASN}{TRP}{LEU}{ILE}{GLN}{THR}{LYS}{ILE}{THR}{ASP}{ARG}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10774-Glucagon-Like_Peptide_2-Arg_GLP-2-Arg_human, Glucagon-like peptide 2 is a neuropeptide that inhibits food intake when injected into the lateral ventricles of the brain and may mediate satiety. It is also a growth factor that stimulates proliferation and blocks apoptosis of intestinal epithelial cells. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Glucagon-Like
Available
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Glucagon-like peptide 2 is a neuropeptide that inhibits food intake when injected into the lateral ventricles of the brain and may mediate satiety. It is also a growth factor that stimulates proliferation and blocks apoptosis of intestinal epithelial cells.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer