Vergleich

Galanin, human Europäischer Partner

ArtNr RP10801-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS ; {GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}{PRO}{HIS}{ALA}{VAL}{GLY}{ASN}{HIS}{ARG}{SER}{PHE}{SER}{ASP}{LYS}{ASN}{GLY}{LEU}{THR}{SER}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10801-Galanin_human, Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr>
Similar products Galanin
Lieferbar
Country of Origin
USA
Storage Conditions
Store the peptide at -20C. Keep container tightly closed.
Description
Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen