English
 
My Account  

REGISTER & SECURE BENEFITS

  • View prices & discounts
  • Free gifts
  • Request & accept offers online
LOGIN NOW Not yet registered? Create your free account here!
Comparison

Galanin, human European Partner

Item no. RP10801-0.5
Manufacturer GenScript
Amount 0.5 mg
Category
Type Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS ; {GLY}{TRP}{THR}{LEU}{ASN}{SER}{ALA}{GLY}{TYR}{LEU}{LEU}{GLY}{PRO}{HIS}{ALA}{VAL}{GLY}{ASN}{HIS}{ARG}{SER}{PHE}{SER}{ASP}{LYS}{ASN}{GLY}{LEU}{THR}{SER}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10801-Galanin_human, Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr>
Similar products Galanin
Available
Country of Origin
USA
Storage Conditions
Store the peptide at -20C. Keep container tightly closed.
Description
Galanin is a neuropeptide that has not been established as a member of any known family of neuropeptides despite repeated efforts to discover related peptides. Its actions are mediated via Gi-protein-coupled receptors and ion channels, usually producing inhibition of secretion of a transmitter or hormone in the nervous and endocrine system. In many respects, these inhibitory actions of galanin remind us of those of gamma-aminobutyric acid (GABA) and of neuropeptide Y (NPY). Galanin coexists with GABA, noradrenaline, 5-hydroxytryptamine (5-HT), and NPY in several regions of the brain.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request product datasheet

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?

sales@hoelzel.de

Recently viewed
  1. Mouse Very Low Density Lipoprotein (VLDL) ELISA Kit
    MBS454083-10x96Tests
  2. Mouse Ghrelin (GHRL) ELISA Kit
    MBS454041-10x96Tests
 
Close

« Back

Contact

Hölzel Diagnostika Handels GmbH
Weinsbergstr 118a
50823 Cologne
Germany

T +49 221 126 02 66
F +49 221 126 02 67

info@hoelzel.de

About Hölzel
Service
Infodesk
Spendenaktion Datenschutzsiegel

Copyright 2025 Hölzel Diagnostika Handels GmbH

To top