Vergleich

Amylin, human, amide Europäischer Partner

ArtNr RP11278-0.5
Hersteller GenScript
Menge 0,5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP11278-Amylin_Diabetes_Associated_Peptide_DAP_IAPP_human_amide, Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin. </td></tr><tr><th>Solubility</th><td colspan="7"> Can be dissolved in DMSO or DMF first and then dilute with water </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep container tightly closed. Store in a cool dry place. </td></tr>
Similar products Amylin
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Peptides & Chemicals
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Other Peptides
Description
Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.
Solubility
Can be dissolved in DMSO or DMF first and then dilute with water
C-Terminal
NH2
Chemical Bridge
Disulfide Bridge: Cys2-Cys7

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0,5 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 20.11.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen