Amylin, human, amide

ArtNr	RP11278-0.5
Hersteller	GenScript
Menge	0,5 mg
Kategorie	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Endocrine Regulation of Lipid Metabolism Enzymes Prostaglandin Synthases Other Fatty Acid Enzymes Peptides By Organ Breast Cancer Thyroid Cancer
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11278-Amylin_Diabetes_Associated_Peptide_DAP_IAPP_human_amide, Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin. </td></tr><tr><th>Solubility</th><td colspan="7"> Can be dissolved in DMSO or DMF first and then dilute with water </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep container tightly closed. Store in a cool dry place. </td></tr>
Similar products	Amylin
Versandbedingung	Raumtemperatur
Lieferbar
Manufacturer - Category	Peptides & Chemicals
Country of Origin	USA
Shipping Temperature	25°C
Storage Conditions	-20°C
Product Line	Other Peptides
Description	Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.
Solubility	Can be dissolved in DMSO or DMF first and then dilute with water
C-Terminal	NH2
Chemical Bridge	Disulfide Bridge: Cys2-Cys7

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0,5 mg

lieferbar

Lieferung vsl. bis 07.08.2025