« Back
Home /
Amylin, human, amide

Amylin, human, amide

Item no.	RP11278-0.5
Manufacturer	GenScript
Amount	0,5 mg
Category	Oncology Neuroscience Metabolism Diabetes Glucose Homeostasis Cholesterol & Lipid Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Endocrine Regulation of Lipid Metabolism Enzymes Prostaglandin Synthases Other Fatty Acid Enzymes Peptides By Organ Breast Cancer Thyroid Cancer
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 ; {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11278-Amylin_Diabetes_Associated_Peptide_DAP_IAPP_human_amide, Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin. </td></tr><tr><th>Solubility</th><td colspan="7"> Can be dissolved in DMSO or DMF first and then dilute with water </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep container tightly closed. Store in a cool dry place. </td></tr>
Similar products	Amylin
Shipping Condition	Room temperature
Available
Manufacturer - Category	Peptides & Chemicals
Country of Origin	USA
Shipping Temperature	25°C
Storage Conditions	-20°C
Product Line	Other Peptides
Description	Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin.
Solubility	Can be dissolved in DMSO or DMF first and then dilute with water
C-Terminal	NH2
Chemical Bridge	Disulfide Bridge: Cys2-Cys7

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0,5 mg

available

Delivery expected until 8/7/2025

Compare

Add to wishlist

Get an offer

Request delivery time