Vergleich

Adrenomedullin (AM) (1-52), human Europäischer Partner

ArtNr RP11288-0.5
Hersteller GenScript
Menge 0,5 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 ; {TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}{LEU}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP11288-Adrenomedullin_1-52_ADM_human, Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before use, store the peptide in the DRY form at 0-5C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions. </td></tr><tr><th>Notes</th><td colspan="7"> The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease.</td></tr>
Similar products Adrenomedullin
Versandbedingung Raumtemperatur
Lieferbar
Manufacturer - Category
Peptides & Chemicals
Country of Origin
USA
Shipping Temperature
25°C
Storage Conditions
-20°C
Product Line
Other Peptides
Description
Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties.
Solubility
The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal
NH2
Chemical Bridge
Disulfide bridge: Cys16-Cys21
Notes
The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0,5 mg
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 27.11.2025 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen