« Back
Home /
Adrenomedullin (AM) (1-52), human

Adrenomedullin (AM) (1-52), human

Item no.	RP11288-0.5
Manufacturer	GenScript
Amount	0,5 mg
Category	Oncology Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Cell Biology Cell Status Necrosis Peptides By Organ Thyroid Cancer
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 ; {TYR}{ARG}{GLN}{SER}{MET}{ASN}{ASN}{PHE}{GLN}{GLY}{LEU}{ARG}{SER}{PHE}{GLY}{CYS}{ARG}{PHE}{GLY}{THR}{CYS}{THR}{VAL}{GLN}{LYS}{LEU}{ALA}{HIS}{GLN}{ILE}{TYR}{GLN}{PHE}{THR}{ASP}{LYS}{ASP}{LYS}{ASP}{
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11288-Adrenomedullin_1-52_ADM_human, Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties. </td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before use, store the peptide in the DRY form at 0-5C. For best and most repeatable results, rehydrate the peptide immediately before use. Do not re-freeze any unused portions. </td></tr><tr><th>Notes</th><td colspan="7"> The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease.</td></tr>
Similar products	Adrenomedullin
Shipping Condition	Room temperature
Available
Manufacturer - Category	Peptides & Chemicals
Country of Origin	USA
Shipping Temperature	25°C
Storage Conditions	-20°C
Product Line	Other Peptides
Description	Adrenomedullin (1-52) is a potent hypotensive peptide hormone with some structural similarity to calcitonin gene-related peptide. Adrenomedullin (1-52) has vasodilatory properties.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Chemical Bridge	Disulfide bridge: Cys16-Cys21
Notes	The peptide elicits a potent and long lasting hypotensive effect. Adrenomedullin (1-52), as supplied is intended for research use only, Do not use it to diagnose or treat any disease.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0,5 mg

available

Delivery expected until 9/4/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer