Vergleich

Prolactin Releasing Peptide (1-31), human Europäischer Partner

ArtNr RP11861-5
Hersteller GenScript
Menge 5.0 mg
Quantity options 0.5 mg 5.0 mg
Kategorie
Typ Peptides
Specific against Human (Homo sapiens)
Purity > 95%
Sequence SRTHRHSMEIRTPDINPAWYASRGIRPVGRF-NH2 ; {SER}{ARG}{THR}{HIS}{ARG}{HIS}{SER}{MET}{GLU}{ILE}{ARG}{THR}{PRO}{ASP}{ILE}{ASN}{PRO}{ALA}{TRP}{TYR}{ALA}{SER}{ARG}{GLY}{ILE}{ARG}{PRO}{VAL}{GLY}{ARG}{PHE}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP11861-Prolactin_Releasing_Peptide_PrRP_1-31, GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. Store in a cool dry place. </td></tr>
Similar products Prolactin
Lieferbar
Country of Origin
USA
Storage Conditions
Store the peptide at -20C. Keep container tightly closed. Store in a cool dry place.
Description
GenScript Prolactin-releasing peptide is a specific prolactin releasing peptide. GenScript prolactin-releasing peptide (PrRP) was originally isolated as an endogenous hypothalamic ligand for the hGR3 orphan receptor and has been shown to release prolactin from dispersed pituitaries harvested from lactating female rats and only at very high doses in cycling females. PrRPs have no effect on prolactin production from dispersed pituitary cells harvested from males.
Solubility
Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
C-Terminal
NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 5.0 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen