« Zurück
Startseite /
[Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human

[Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human

ArtNr	RP11926-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Peptides
Typ	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11-27) ; {THR}{ALA}{PRO}{ARG}{SER}{LEU}{ARG}{ARG}{SER}{SER}{CYS}{PHE}{GLY}{GLY}{ARG}{MET}{ASP}{ARG}{ILE}{GLY}{ALA}{GLN}{SER}{GLY}{LEU}{GLY}{CYS}{ASN}{SER}{PHE}{ARG}{TYR}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11926-Thr-Ala-Pro-Arg-Atrial_Natriuretic_Peptide, Urodilatin is a natriuretic factor that is produced in the kidney and secreted into the urine. Urodilatin is found to regulate water and sodium reabsorption in the collecting duct and it is also known to relieve patients' symptoms in decompensated CHF by improving the hemodynamic state.</td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr><tr><th>Notes</th><td colspan="7"> (CDD = Cardiodilatin, CDD/ANP (99-126) = ANP). potent vasorelaxant</td></tr>
Similar products	[Thr1-Ala2-Pro3-Arg4]-Atrial
Lieferbar
Country of Origin	USA
Storage Conditions	Store the peptide at -20C. Keep container tightly closed.
Description	Urodilatin is a natriuretic factor that is produced in the kidney and secreted into the urine. Urodilatin is found to regulate water and sodium reabsorption in the collecting duct and it is also known to relieve patients' symptoms in decompensated CHF by improving the hemodynamic state.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Chemical Bridge	11-27
Notes	(CDD = Cardiodilatin, CDD/ANP (99-126) = ANP). potent vasorelaxant

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern