« Back
Home /
[Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human

[Thr1-Ala2-Pro3-Arg4]-Atrial Natriuretic Peptide (ANP) (Urodilatin), human

Item no.	RP11926-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology By Cell Type Carcinoma Peptides & Proteins Peptides
Type	Peptides
Specific against	Human (Homo sapiens)
Purity	> 95%
Sequence	TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 11-27) ; {THR}{ALA}{PRO}{ARG}{SER}{LEU}{ARG}{ARG}{SER}{SER}{CYS}{PHE}{GLY}{GLY}{ARG}{MET}{ASP}{ARG}{ILE}{GLY}{ALA}{GLN}{SER}{GLY}{LEU}{GLY}{CYS}{ASN}{SER}{PHE}{ARG}{TYR}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP11926-Thr-Ala-Pro-Arg-Atrial_Natriuretic_Peptide, Urodilatin is a natriuretic factor that is produced in the kidney and secreted into the urine. Urodilatin is found to regulate water and sodium reabsorption in the collecting duct and it is also known to relieve patients' symptoms in decompensated CHF by improving the hemodynamic state.</td></tr><tr><th>Solubility</th><td colspan="7"> The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store the peptide at -20C. Keep container tightly closed. </td></tr><tr><th>Notes</th><td colspan="7"> (CDD = Cardiodilatin, CDD/ANP (99-126) = ANP). potent vasorelaxant</td></tr>
Similar products	[Thr1-Ala2-Pro3-Arg4]-Atrial
Available
Country of Origin	USA
Storage Conditions	Store the peptide at -20C. Keep container tightly closed.
Description	Urodilatin is a natriuretic factor that is produced in the kidney and secreted into the urine. Urodilatin is found to regulate water and sodium reabsorption in the collecting duct and it is also known to relieve patients' symptoms in decompensated CHF by improving the hemodynamic state.
Solubility	The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents.
Chemical Bridge	11-27
Notes	(CDD = Cardiodilatin, CDD/ANP (99-126) = ANP). potent vasorelaxant

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer