Urocortin II, mouse

ArtNr	RP10099-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Metabolism Glucose Homeostasis Peptides & Proteins Obesity Peptides
Typ	Peptides
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95%
Sequence	VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 ; {VAL}{ILE}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{ILE}{GLY}{LEU}{LEU}{ARG}{ILE}{LEU}{LEU}{GLU}{GLN}{ALA}{ARG}{TYR}{LYS}{ALA}{ALA}{ARG}{ASN}{GLN}{ALA}{ALA}{THR}{ASN}{ALA}{GLN}{ILE}{LEU}{ALA}{HIS}{VAL}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10099-Urocortin_II_UCN-II_mouse, Peptides encoded by the Urocortin (Ucn) II gene is highly expressed in mouse skin and skeletal muscle, and the peptides which known as stresscopin-related peptide were identified as new members of the corticotropin-releasing factor (CRF) family. Urocortin II, mouse is also a corticotropin-releasing hormone (CRH)-related peptide. It is found that the selective CRF receptor agonists mouse urocortin II (20-60 microg/kg) can inhibit significantly gastric emptying without modifying colonic transit.</td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve peptide in 60% Acetonitrile with 0.1% TFA solution - then dilute with desired buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Storage at -20C. Keep tightly closed. </td></tr>
Similar products	Urocortin
Lieferbar
Country of Origin	USA
Storage Conditions	Storage at -20C. Keep tightly closed.
Description	Peptides encoded by the Urocortin (Ucn) II gene is highly expressed in mouse skin and skeletal muscle, and the peptides which known as stresscopin-related peptide were identified as new members of the corticotropin-releasing factor (CRF) family. Urocortin II, mouse is also a corticotropin-releasing hormone (CRH)-related peptide. It is found that the selective CRF receptor agonists mouse urocortin II (20-60 microg/kg) can inhibit significantly gastric emptying without modifying colonic transit.
Solubility	Insoluble in water. Dissolve peptide in 60% Acetonitrile with 0.1% TFA solution - then dilute with desired buffer.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern