« Back
Home /
Urocortin II, mouse

Urocortin II, mouse

Item no.	RP10099-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Metabolism Glucose Homeostasis Peptides & Proteins Obesity Peptides
Type	Peptides
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95%
Sequence	VILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHV-NH2 ; {VAL}{ILE}{LEU}{SER}{LEU}{ASP}{VAL}{PRO}{ILE}{GLY}{LEU}{LEU}{ARG}{ILE}{LEU}{LEU}{GLU}{GLN}{ALA}{ARG}{TYR}{LYS}{ALA}{ALA}{ARG}{ASN}{GLN}{ALA}{ALA}{THR}{ASN}{ALA}{GLN}{ILE}{LEU}{ALA}{HIS}{VAL}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10099-Urocortin_II_UCN-II_mouse, Peptides encoded by the Urocortin (Ucn) II gene is highly expressed in mouse skin and skeletal muscle, and the peptides which known as stresscopin-related peptide were identified as new members of the corticotropin-releasing factor (CRF) family. Urocortin II, mouse is also a corticotropin-releasing hormone (CRH)-related peptide. It is found that the selective CRF receptor agonists mouse urocortin II (20-60 microg/kg) can inhibit significantly gastric emptying without modifying colonic transit.</td></tr><tr><th>Solubility</th><td colspan="7"> Insoluble in water. Dissolve peptide in 60% Acetonitrile with 0.1% TFA solution - then dilute with desired buffer. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Storage at -20C. Keep tightly closed. </td></tr>
Similar products	Urocortin
Available
Country of Origin	USA
Storage Conditions	Storage at -20C. Keep tightly closed.
Description	Peptides encoded by the Urocortin (Ucn) II gene is highly expressed in mouse skin and skeletal muscle, and the peptides which known as stresscopin-related peptide were identified as new members of the corticotropin-releasing factor (CRF) family. Urocortin II, mouse is also a corticotropin-releasing hormone (CRH)-related peptide. It is found that the selective CRF receptor agonists mouse urocortin II (20-60 microg/kg) can inhibit significantly gastric emptying without modifying colonic transit.
Solubility	Insoluble in water. Dissolve peptide in 60% Acetonitrile with 0.1% TFA solution - then dilute with desired buffer.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer