Vergleich

Growth Hormone Releasing Factor (GHRF), mouse Europäischer Partner

ArtNr RP10736-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against Mouse (Murine, Mus musculus)
Purity > 95%
Sequence HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS ; {HIS}{VAL}{ASP}{ALA}{ILE}{PHE}{THR}{THR}{ASN}{TYR}{ARG}{LYS}{LEU}{LEU}{SER}{GLN}{LEU}{TYR}{ALA}{ARG}{LYS}{VAL}{ILE}{GLN}{ASP}{ILE}{MET}{ASN}{LYS}{GLN}{GLY}{GLU}{ARG}{ILE}{GLN}{GLU}{GLN}{ARG}{ALA}{ARG}{LEU}{SER}
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10736-Growth_Hormone_Releasing_Factor_GHRF_mouse_mGHRH, Mouse growth hormone-releasing hormone (mGHRH) is synthesized by the hypothalamus, but is present also in the immune cells. Some recent data indicate also an immunomodulatory role of the neuropeptide. It can be examined that the influence of GHRH (1-44) on interleukin-6 and interleukin-8 secretion from human peripheral blood mononuclear cells cultured in vitro. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products Growth
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C.
Description
Mouse growth hormone-releasing hormone (mGHRH) is synthesized by the hypothalamus, but is present also in the immune cells. Some recent data indicate also an immunomodulatory role of the neuropeptide. It can be examined that the influence of GHRH (1-44) on interleukin-6 and interleukin-8 secretion from human peripheral blood mononuclear cells cultured in vitro.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen