« Back
Home /
Growth Hormone Releasing Factor (GHRF), mouse

Growth Hormone Releasing Factor (GHRF), mouse

Item no.	RP10736-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Neuroscience Neuroinflammation Metabolism Diabetes Glucose Homeostasis Molecular Targets for Neuroscience By Cell Type Carcinoma Hematology Leukemia Peptides & Proteins Cell Biology Obesity Cell Culture Cytokines Cell Status Necrosis Peptides
Type	Peptides
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95%
Sequence	HVDAIFTTNYRKLLSQLYARKVIQDIMNKQGERIQEQRARLS ; {HIS}{VAL}{ASP}{ALA}{ILE}{PHE}{THR}{THR}{ASN}{TYR}{ARG}{LYS}{LEU}{LEU}{SER}{GLN}{LEU}{TYR}{ALA}{ARG}{LYS}{VAL}{ILE}{GLN}{ASP}{ILE}{MET}{ASN}{LYS}{GLN}{GLY}{GLU}{ARG}{ILE}{GLN}{GLU}{GLN}{ARG}{ALA}{ARG}{LEU}{SER}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10736-Growth_Hormone_Releasing_Factor_GHRF_mouse_mGHRH, Mouse growth hormone-releasing hormone (mGHRH) is synthesized by the hypothalamus, but is present also in the immune cells. Some recent data indicate also an immunomodulatory role of the neuropeptide. It can be examined that the influence of GHRH (1-44) on interleukin-6 and interleukin-8 secretion from human peripheral blood mononuclear cells cultured in vitro. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. </td></tr>
Similar products	Growth
Available
Country of Origin	USA
Storage Conditions	Store at -20C.
Description	Mouse growth hormone-releasing hormone (mGHRH) is synthesized by the hypothalamus, but is present also in the immune cells. Some recent data indicate also an immunomodulatory role of the neuropeptide. It can be examined that the influence of GHRH (1-44) on interleukin-6 and interleukin-8 secretion from human peripheral blood mononuclear cells cultured in vitro.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer