beta-Amyloid (42-1)

ArtNr	RP10034-0.5
Hersteller	GenScript
Menge	0.5 mg
Quantity options	0.5 mg 1 mg
Kategorie	Oncology Neuroscience Molecular Targets for Neuroscience Aging & Neurological Disorders Protein Aggregation, Clearance & Misfolding By Cell Type Peptides & Proteins Adenocarcinoma Peptides
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD ; {ALA}{ILE}{VAL}{VAL}{GLY}{GLY}{VAL}{MET}{LEU}{GLY}{ILE}{ILE}{ALA}{GLY}{LYS}{ASN}{SER}{GLY}{VAL}{ASP}{GLU}{ALA}{PHE}{PHE}{VAL}{LEU}{LYS}{GLN}{HIS}{HIS}{VAL}{GLU}{TYR}{GLY}{SER}{ASP}{HIS}{ARG}{PHE}{GLU}{ALA}{ASP}
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10034-beta-Amyloid_1-42, Beta amyloid (42-1) is the reverse of beta amyloid (1-42), the latter is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer's disease (AD) brain. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C. Keep tightly closed. Store in a cool dry place. </td></tr>
Similar products	beta-Amyloid
Lieferbar
Country of Origin	USA
Storage Conditions	Store at -20C. Keep tightly closed. Store in a cool dry place.
Description	Beta amyloid (42-1) is the reverse of beta amyloid (1-42), the latter is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer's disease (AD) brain.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP10034-0.5-datasheet.pdf

RP10034-0.5-safety-datasheet.pdf