Urotensin I

ArtNr	RP10094-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Oncology Metabolism Glucose Homeostasis Regulation of Appetite Peptides & Proteins Obesity Cardiovascular Research Atherosclerosis Peptides By Organ Colorectal Cancer
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 ; {ASN}{ASP}{ASP}{PRO}{PRO}{ILE}{SER}{ILE}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{ASN}{MET}{ILE}{GLU}{MET}{ALA}{ARG}{ILE}{GLU}{ASN}{GLU}{ARG}{GLU}{GLN}{ALA}{GLY}{LEU}{ASN}{ARG}{LYS}{TYR}{LEU}{ASP}{GLU}{VAL}-N
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10094-Urotensin_I_U_I, Urotensins are neuropeptide secreted from the urophysis in the caudal neurosecretory system of the fishes. Two bioactive Urotensins, Urotensin I and Urotensin II have been cloned from various species including mammals. Urotensin I is a 41 aa peptide, which showed prolonged hypotensive effects in mammals. Urotensin I is structurally similar to mammalian corticotropin-releasing factor. Urotensin I is found in the brain of most fish species. It may be involved in the regulation of blood pressure in fish. Urotensin I is closely related to mammalian urocortin and releases ACTH from cultured rat pituitary cells. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0-5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Urotensin
Lieferbar
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0-5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Urotensins are neuropeptide secreted from the urophysis in the caudal neurosecretory system of the fishes. Two bioactive Urotensins, Urotensin I and Urotensin II have been cloned from various species including mammals. Urotensin I is a 41 aa peptide, which showed prolonged hypotensive effects in mammals. Urotensin I is structurally similar to mammalian corticotropin-releasing factor. Urotensin I is found in the brain of most fish species. It may be involved in the regulation of blood pressure in fish. Urotensin I is closely related to mammalian urocortin and releases ACTH from cultured rat pituitary cells.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 11.09.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern