« Back
Home /
Urotensin I

Urotensin I

Item no.	RP10094-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Oncology Metabolism Glucose Homeostasis Regulation of Appetite Peptides & Proteins Obesity Cardiovascular Research Atherosclerosis Peptides By Organ Colorectal Cancer
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	NDDPPISIDLTFHLLRNMIEMARIENEREQAGLNRKYLDEV-NH2 ; {ASN}{ASP}{ASP}{PRO}{PRO}{ILE}{SER}{ILE}{ASP}{LEU}{THR}{PHE}{HIS}{LEU}{LEU}{ARG}{ASN}{MET}{ILE}{GLU}{MET}{ALA}{ARG}{ILE}{GLU}{ASN}{GLU}{ARG}{GLU}{GLN}{ALA}{GLY}{LEU}{ASN}{ARG}{LYS}{TYR}{LEU}{ASP}{GLU}{VAL}-N
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10094-Urotensin_I_U_I, Urotensins are neuropeptide secreted from the urophysis in the caudal neurosecretory system of the fishes. Two bioactive Urotensins, Urotensin I and Urotensin II have been cloned from various species including mammals. Urotensin I is a 41 aa peptide, which showed prolonged hypotensive effects in mammals. Urotensin I is structurally similar to mammalian corticotropin-releasing factor. Urotensin I is found in the brain of most fish species. It may be involved in the regulation of blood pressure in fish. Urotensin I is closely related to mammalian urocortin and releases ACTH from cultured rat pituitary cells. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0-5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr>
Similar products	Urotensin
Available
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0-5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Urotensins are neuropeptide secreted from the urophysis in the caudal neurosecretory system of the fishes. Two bioactive Urotensins, Urotensin I and Urotensin II have been cloned from various species including mammals. Urotensin I is a 41 aa peptide, which showed prolonged hypotensive effects in mammals. Urotensin I is structurally similar to mammalian corticotropin-releasing factor. Urotensin I is found in the brain of most fish species. It may be involved in the regulation of blood pressure in fish. Urotensin I is closely related to mammalian urocortin and releases ACTH from cultured rat pituitary cells.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 9/11/2025

Express Delivery: Save 2 days

Compare

Add to wishlist

Get an offer