Vergleich

Pancreatic Polypeptide, avian Europäischer Partner

ArtNr RP10397-0.5
Hersteller GenScript
Menge 0.5 mg
Kategorie
Typ Peptides
Specific against other
Purity > 95%
Sequence GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2 ; {GLY}{PRO}{SER}{GLN}{PRO}{THR}{TYR}{PRO}{GLY}{ASP}{ASP}{ALA}{PRO}{VAL}{GLU}{ASP}{LEU}{ILE}{ARG}{PHE}{TYR}{ASP}{ASN}{LEU}{GLN}{GLN}{TYR}{LEU}{ASN}{VAL}{VAL}{THR}{ARG}{HIS}{ARG}{TYR}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10397-Pancreatic_Polypeptide_PP_avian, Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting, diabetes, and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr><tr><th>Notes</th><td colspan="7"> Freeze within 4 hours of collection.</td></tr>
Similar products Pancreatic
Lieferbar
Country of Origin
USA
Storage Conditions
Store at -20C
Description
Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting, diabetes, and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis.
C-Terminal
NH2
Notes
Freeze within 4 hours of collection.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 0.5 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen