Comparison

Pancreatic Polypeptide, avian European Partner

Item no. RP10397-0.5
Manufacturer GenScript
Amount 0.5 mg
Category
Type Peptides
Specific against other
Purity > 95%
Sequence GPSQPTYPGDDAPVEDLIRFYDNLQQYLNVVTRHRY-NH2 ; {GLY}{PRO}{SER}{GLN}{PRO}{THR}{TYR}{PRO}{GLY}{ASP}{ASP}{ALA}{PRO}{VAL}{GLU}{ASP}{LEU}{ILE}{ARG}{PHE}{TYR}{ASP}{ASN}{LEU}{GLN}{GLN}{TYR}{LEU}{ASN}{VAL}{VAL}{THR}{ARG}{HIS}{ARG}{TYR}-NH2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias peptide/RP10397-Pancreatic_Polypeptide_PP_avian, Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting, diabetes, and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Store at -20C </td></tr><tr><th>Notes</th><td colspan="7"> Freeze within 4 hours of collection.</td></tr>
Similar products Pancreatic
Available
Country of Origin
USA
Storage Conditions
Store at -20C
Description
Pancreatic polypeptide (PP) is a 36-amino-acid secretory peptide that is predominantly produced by the pancreas. The exact physiologic role of PP in healthy individuals has not been fully defined. It has been shown, however, that pancreatic polypeptide affects the secretion of pancreatic enzymes, water, and electrolytes. Its effect is biphasic in that PP initially enhances secretion and then inhibits secretion. PP increases gastric emptying and gut motility. Pancreatic polypeptide also relaxes the pyloric and ileocecocolic sphincters, the colon, and gallbladder. PP levels increase after ingestion of food and remain elevated from four to eight hours. Prolonged fasting, diabetes, and exercise can also increase PP levels. Serum PP levels can be elevated in as many as 50% of patients with carcinoid syndrome. Increased levels can also be found in patients with duodenal ulcers and in patients with type I diabetes. PP levels are often low in patients with pancreatic insufficiency or pancreatitis.
C-Terminal
NH2
Notes
Freeze within 4 hours of collection.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.5 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close