Helodermin

ArtNr	RP10591-0.5
Hersteller	GenScript
Menge	0.5 mg
Kategorie	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Typ	Peptides
Specific against	other
Purity	> 95%
Sequence	HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH2 ; {HIS}{SER}{ASP}{ALA}{ILE}{PHE}{THR}{GLU}{GLU}{TYR}{SER}{LYS}{LEU}{LEU}{ALA}{LYS}{LEU}{ALA}{LEU}{GLN}{LYS}{TYR}{LEU}{ALA}{SER}{ILE}{LEU}{GLY}{SER}{ARG}{THR}{SER}{PRO}{PRO}{PRO}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10591-Helodermin_VIP-PHI-like_peptide, Some studies show that helodermin on vascular physiology has effect on anesthetized dogs using a synthetic replicate of helodermin and helodermin related peptides. Intraarterial infusion of helodermin caused a dose-dependent increase in femoral blood flow. Helodermin was 16 times less potent than VIP and 5 times more potent than PHM (human PHI). The results demonstrate the VIP-like vasodilating activity and cardiovascular effects of helodermin in anesthetized dogs. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr><tr><th>Notes</th><td colspan="7"> Helodermin is a VIP-PHI-like peptide.</td></tr>
Similar products	Helodermin
Lieferbar
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Some studies show that helodermin on vascular physiology has effect on anesthetized dogs using a synthetic replicate of helodermin and helodermin related peptides. Intraarterial infusion of helodermin caused a dose-dependent increase in femoral blood flow. Helodermin was 16 times less potent than VIP and 5 times more potent than PHM (human PHI). The results demonstrate the VIP-like vasodilating activity and cardiovascular effects of helodermin in anesthetized dogs.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Notes	Helodermin is a VIP-PHI-like peptide.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 0.5 mg

lieferbar

Lieferung vsl. bis 08.01.2026

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern