« Back
Home /
Helodermin

Helodermin

Item no.	RP10591-0.5
Manufacturer	GenScript
Amount	0.5 mg
Category	Neuroscience Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Specific against	other
Purity	> 95%
Sequence	HSDAIFTEEYSKLLAKLALQKYLASILGSRTSPPP-NH2 ; {HIS}{SER}{ASP}{ALA}{ILE}{PHE}{THR}{GLU}{GLU}{TYR}{SER}{LYS}{LEU}{LEU}{ALA}{LYS}{LEU}{ALA}{LEU}{GLN}{LYS}{TYR}{LEU}{ALA}{SER}{ILE}{LEU}{GLY}{SER}{ARG}{THR}{SER}{PRO}{PRO}{PRO}-NH2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	peptide/RP10591-Helodermin_VIP-PHI-like_peptide, Some studies show that helodermin on vascular physiology has effect on anesthetized dogs using a synthetic replicate of helodermin and helodermin related peptides. Intraarterial infusion of helodermin caused a dose-dependent increase in femoral blood flow. Helodermin was 16 times less potent than VIP and 5 times more potent than PHM (human PHI). The results demonstrate the VIP-like vasodilating activity and cardiovascular effects of helodermin in anesthetized dogs. </td></tr><tr><th>Solubility</th><td colspan="7"> Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. </td></tr><tr><th>Purity</th><td colspan="7"> > 95% </td></tr><tr><th>Storage</th><td colspan="7"> Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions. </td></tr><tr><th>Notes</th><td colspan="7"> Helodermin is a VIP-PHI-like peptide.</td></tr>
Similar products	Helodermin
Available
Country of Origin	USA
Storage Conditions	Before using, store the peptide in the DRY form at 0 - 5C. For best and repeatable results, rehydrate the peptide immediately before using. Do not re-freeze any unused portions.
Description	Some studies show that helodermin on vascular physiology has effect on anesthetized dogs using a synthetic replicate of helodermin and helodermin related peptides. Intraarterial infusion of helodermin caused a dose-dependent increase in femoral blood flow. Helodermin was 16 times less potent than VIP and 5 times more potent than PHM (human PHI). The results demonstrate the VIP-like vasodilating activity and cardiovascular effects of helodermin in anesthetized dogs.
Solubility	Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents.
C-Terminal	NH2
Notes	Helodermin is a VIP-PHI-like peptide.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 0.5 mg

available

Delivery expected until 1/8/2026

Express Delivery: Save 3 days

Compare

Add to wishlist

Get an offer